FABP3 Peptide - N-terminal region
FABP3 Peptide - N-terminal region
Product Specifications
Product Name Alternative
Mdgi, Fabph1, Fabph4, H-FABP, Fabph-1, Fabph-4
UniProt
P11404
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_034304.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDTITIKTQSTFKNTEI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS9424286-01 0.02 mg
Recombinant Human F-box/WD repeat-containing protein 4 (FBXW4)
Sign In for Pricing
View Details MBS9424286-02 0.1 mg
Recombinant Human F-box/WD repeat-containing protein 4 (FBXW4)
Sign In for Pricing
View Details MBS9424286-03 1 mg
Recombinant Human F-box/WD repeat-containing protein 4 (FBXW4)
Sign In for Pricing
View Details MBS9424286-04 5x 1 mg
Recombinant Human F-box/WD repeat-containing protein 4 (FBXW4)
Sign In for Pricing
View Details