What is the catalog number for FABP3 Peptide - N-terminal region?

The catalog number for FABP3 Peptide - N-terminal region is orb1997683.

What sizes are available for FABP3 Peptide - N-terminal region?

FABP3 Peptide - N-terminal region is available in the following size(s): 100 µg.

Is FABP3 Peptide - N-terminal region in stock?

FABP3 Peptide - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

FABP3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Mdgi, Fabph1, Fabph4, H-FABP, Fabph-1, Fabph-4

UniProt

P11404

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_034304.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDTITIKTQSTFKNTEI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

K1666601 3x 1.0 µg

PLEKHF2 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing

View Details

N8655 500 g

NZYDT Broth (Powder)

Sign In for Pricing

View Details

T9-222-T025 25 Tests

Anti-Hu CD45 PerCP-Cy™5.5

Sign In for Pricing

View Details

orb1001872 100 µL

MYO16 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing

View Details

MBS9511137-01 0.05 mL

Anti-Human CD8 (ABT455) Mouse Monoclonal Antibody

Sign In for Pricing

View Details

MBS9511137-02 0.1 mL

Anti-Human CD8 (ABT455) Mouse Monoclonal Antibody

Sign In for Pricing

View Details