Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LSM1 Peptide - middlel region

LSM1 Peptide - middlel region

Product Specifications

Product Name Alternative

CASM, 2810025O06Rik

UniProt

Q8VC85

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_080308.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LRDGRTLIGFLRSIDQFANLVLHQTVERIHVGKKYGDIPRGIFVVRGENV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human HES2 shRNA (UAS) - Lentiviral human HES2 shRNA (UAS) plasmid
GTR15151831 1 Vial

Lentiviral human HES2 shRNA (UAS) - Lentiviral human HES2 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Anti- (Mouse) Dnmt1 Antibody (Center)
M00172-2-400ul 400 µL

Anti- (Mouse) Dnmt1 Antibody (Center)

Sign In for Pricing
View Details
Pnmal1 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4068704 1.0 µg DNA

Pnmal1 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Rat STX7 shRNA Plasmid
abx986063-01 150 µg

Rat STX7 shRNA Plasmid

Sign In for Pricing
View Details
Rat STX7 shRNA Plasmid
abx986063-02 300 µg

Rat STX7 shRNA Plasmid

Sign In for Pricing
View Details
Ampicillin (Sodium) 100 mg/mL Solution
A-301-SL50-10mL 10 mL

Ampicillin (Sodium) 100 mg/mL Solution

Sign In for Pricing
View Details