Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LSM1 Peptide - middlel region

LSM1 Peptide - middlel region

Product Specifications

Product Name Alternative

CASM, 2810025O06Rik

UniProt

Q8VC85

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_080308.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LRDGRTLIGFLRSIDQFANLVLHQTVERIHVGKKYGDIPRGIFVVRGENV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OFD1P16Y ORF Vector (Human) (pORF)
32465011 1.0 µg DNA

OFD1P16Y ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Rabbit anti-CTH Antibody
MBS4506778-01 0.05 mL

Rabbit anti-CTH Antibody

Sign In for Pricing
View Details
Rabbit anti-CTH Antibody
MBS4506778-02 0.1 mL

Rabbit anti-CTH Antibody

Sign In for Pricing
View Details
Rabbit anti-CTH Antibody
MBS4506778-03 5x 0.1 mL

Rabbit anti-CTH Antibody

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae Ribosome maturation factor RimP (rimP)
MBS1078276-01 0.02 mg (E-Coli)

Recombinant Streptococcus pneumoniae Ribosome maturation factor RimP (rimP)

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae Ribosome maturation factor RimP (rimP)
MBS1078276-02 0.1 mg (E-Coli)

Recombinant Streptococcus pneumoniae Ribosome maturation factor RimP (rimP)

Sign In for Pricing
View Details