SNAPIN Peptide - middlel region
SNAPIN Peptide - middlel region
Product Specifications
Product Name Alternative
25kDa, Snapap, Bloc1s7, AA407989, AV026596, Snap25bp
UniProt
Q9Z266
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_598615.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGVYPPGSPS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K3458506 1.0 µg DNA
Satl1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
Sign In for Pricing
View Details 
MBS2075776-01 0.1 mL
FITC-Linked Polyclonal Antibody to Sirtuin 1 (SIRT1)
Sign In for Pricing
View Details MBS2075776-02 0.2 mL
FITC-Linked Polyclonal Antibody to Sirtuin 1 (SIRT1)
Sign In for Pricing
View Details MBS2075776-03 0.5 mL
FITC-Linked Polyclonal Antibody to Sirtuin 1 (SIRT1)
Sign In for Pricing
View Details MBS2075776-04 1 mL
FITC-Linked Polyclonal Antibody to Sirtuin 1 (SIRT1)
Sign In for Pricing
View Details