SNAPIN Peptide - middlel region
SNAPIN Peptide - middlel region
Product Specifications
Product Name Alternative
25kDa, Snapap, Bloc1s7, AA407989, AV026596, Snap25bp
UniProt
Q9Z266
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_598615.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGVYPPGSPS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6342445-01 0.2 mL
RNASE9, CT (RNASE9, Inactive ribonuclease-like protein 9) (AP)
Sign In for Pricing
View Details MBS6342445-02 5x 0.2 mL
RNASE9, CT (RNASE9, Inactive ribonuclease-like protein 9) (AP)
Sign In for Pricing
View Details 
12105-05061 5x 30 µg
Canine Albumin AssayLite™ Antibody (APC Conjugate)
Sign In for Pricing
View Details ![ACE2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D2] (Angiotensin Converting Enzyme 2)](https://cdn.genprice.uk/products/937/6868c3bb994c49e6dc3fd6d0/imageurl/ta803842bm.webp)
TA803842BM 100 µL
ACE2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D2] (Angiotensin Converting Enzyme 2)
Sign In for Pricing
View Details bs-12720R-BF488 100 µL
PLEKHA1 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
Sign In for Pricing
View Details