Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2N Peptide - middlel region

UBE2N Peptide - middlel region

Product Specifications

Product Name Alternative

UBC13, AL022654, BB101821, 1500026J17Rik

UniProt

P61089

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_542127.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Testis
CR560532 5 µg

Tissue Total RNA, Testis

Sign In for Pricing
View Details
MTMR9 Rabbit Polyclonal Antibody
TA378763 100 µL

MTMR9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
1-Hexyl-2-phenyl-4-(1-naphthoyl)pyrroleJWH-147
TRC-H297400-5MG 5 mg

1-Hexyl-2-phenyl-4-(1-naphthoyl)pyrroleJWH-147

Sign In for Pricing
View Details
CD68 (Macrophage Marker) (C68/2501), CF514 conjugate, 0.1mg/mL
BNC142501-100 1x 100 µL

CD68 (Macrophage Marker) (C68/2501), CF514 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FAAH1 (FAAH) Human Gene Knockout Kit (CRISPR)
KN210331 1 Kit

FAAH1 (FAAH) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD40 / TNFRSF5 / CD40L-Receptor (C40/2383), Biotin conjugate, 0.1mg/mL
BNCB2383-100 1x 100 µL

CD40 / TNFRSF5 / CD40L-Receptor (C40/2383), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details