GABARAPL1 Peptide - N-terminal region
GABARAPL1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
GECI, Apg8l, Atg8l, AI196471, MNCb-0091, 3110025G09Rik, 9130422N19Rik
UniProt
Q9DCD6
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_065615.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400226-500 1x 500 µL
Pmel17 / gp100 / SILV (NKI-beteb), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040031-100 1x 100 µL
Mucin 5AC (MUC5AC) (45M1), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472783-500 1x 500 µL
C1QA / Complement C1q A-Chain (C1QA/2783), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041030-500 1x 500 µL
CD66 (CEA) (C66/1030), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNCB0391-500 1x 500 µL
CD81 / TAPA-1 (1.3.3.22), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740580-500 1x 500 µL
Histone H1 (1415-1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details