CD247 Peptide - middlel region
CD247 Peptide - middlel region
Product Specifications
Product Name Alternative
Cd3, T3z, Cd3h, Cd3z, Tcrk, Tcrz, Cd3-eta, Cd3zeta, AW552088, Cd3-zeta, 4930549J05Rik, A430104F18Rik
UniProt
P24161
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001106862.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NPQEGVYNALQKDKMAEAYSEIGTKGERRRGKGHDGLYQGLSTATKDTYD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-D014471-1G 1 g
2',3'-Didehydro-2',3'-dideoxy-5'-acetate Inosine
Sign In for Pricing
View Details 
PKSH030911 50 µg
Recombinant Human PTX3/Pentraxin 3/TSG-14 Protein (His Tag)
Sign In for Pricing
View Details 
100420T0-AAT 100 Tests
MFluor™ Blue 570 Anti-human CD4 Antibody *SK3*
Sign In for Pricing
View Details 