Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD247 Peptide - middlel region

CD247 Peptide - middlel region

Product Specifications

Product Name Alternative

Cd3, T3z, Cd3h, Cd3z, Tcrk, Tcrz, Cd3-eta, Cd3zeta, AW552088, Cd3-zeta, 4930549J05Rik, A430104F18Rik

UniProt

P24161

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001106862.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NPQEGVYNALQKDKMAEAYSEIGTKGERRRGKGHDGLYQGLSTATKDTYD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF3D (NM_003753) Human Over-expression Lysate
LC401237 20 µg

EIF3D (NM_003753) Human Over-expression Lysate

Sign In for Pricing
View Details
N-Propylsulfamide Potassium Salt
TRC-P838475-25G 25 g

N-Propylsulfamide Potassium Salt

Sign In for Pricing
View Details
Anti-AcmNPV Envelope glycoprotein gp64/AcmNPV-gp64 Polyclonal Antibody
E-AB-V1053-01 20 µL

Anti-AcmNPV Envelope glycoprotein gp64/AcmNPV-gp64 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-AcmNPV Envelope glycoprotein gp64/AcmNPV-gp64 Polyclonal Antibody
E-AB-V1053-02 100 µL

Anti-AcmNPV Envelope glycoprotein gp64/AcmNPV-gp64 Polyclonal Antibody

Sign In for Pricing
View Details
QPRT (NM_014298) Human Recombinant Protein
TP720230M 50 µg

QPRT (NM_014298) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue Protein Lysate, Ovary
CP565562 150 µg

Tissue Protein Lysate, Ovary

Sign In for Pricing
View Details