Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GARS Peptide - C-terminal region

GARS Peptide - C-terminal region

Product Specifications

Product Name Alternative

Nmf249, Sgrp23, GENA202, Gena201

UniProt

Q9CZD3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_851009.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ELSEALTRNGVSHKVDDSSGSIGRRYARTDEIGVAFGITIDFDTVNKTPH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Dectin-1 ELISA Kit
MBS2614278-01 48 Well

Bovine Dectin-1 ELISA Kit

Sign In for Pricing
View Details
Bovine Dectin-1 ELISA Kit
MBS2614278-02 96 Well

Bovine Dectin-1 ELISA Kit

Sign In for Pricing
View Details
Bovine Dectin-1 ELISA Kit
MBS2614278-03 5x 96 Well

Bovine Dectin-1 ELISA Kit

Sign In for Pricing
View Details
Bovine Dectin-1 ELISA Kit
MBS2614278-04 10x 96 Well

Bovine Dectin-1 ELISA Kit

Sign In for Pricing
View Details
NUSAP, NT (NUSAP1, ANKT, Nucleolar and spindle-associated protein 1) (AP)
MBS6327326-01 0.2 mL

NUSAP, NT (NUSAP1, ANKT, Nucleolar and spindle-associated protein 1) (AP)

Sign In for Pricing
View Details
NUSAP, NT (NUSAP1, ANKT, Nucleolar and spindle-associated protein 1) (AP)
MBS6327326-02 5x 0.2 mL

NUSAP, NT (NUSAP1, ANKT, Nucleolar and spindle-associated protein 1) (AP)

Sign In for Pricing
View Details