GARS Peptide - C-terminal region
GARS Peptide - C-terminal region
Product Specifications
Product Name Alternative
Nmf249, Sgrp23, GENA202, Gena201
UniProt
Q9CZD3
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_851009.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ELSEALTRNGVSHKVDDSSGSIGRRYARTDEIGVAFGITIDFDTVNKTPH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
127553-AP 100 µL
GRK6 (G-Protein Coupled Receptor Kinase 6, G-Protein-coupled Receptor Kinase GRK6, GPRK6, FLJ32135) (AP) discontinued
Sign In for Pricing
View Details 
ELI-48098h 96 Tests
Human Epididymal secretory protein E3-beta, EDDM3B ELISA KIT
Sign In for Pricing
View Details K6652603 1.0 µg DNA
Spats2l sgRNA CRISPR Lentivector (Rat) (Target 2)
Sign In for Pricing
View Details abx325701-02 100 µg
5'-Nucleotidase, Cytosolic IA (NT5C1A) Antibody
Sign In for Pricing
View Details RAA00650-01 100 µL
Neurofilament heavy polypeptide Recombinant Monoclonal Antibody
Sign In for Pricing
View Details