EHF Peptide - C-terminal region
EHF Peptide - C-terminal region
Product Specifications
Product Name Alternative
AU019492, 9030625L19Rik
UniProt
O70273
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_031940.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KKKNNSSMTYEKLSRAMRYYYKREILERVDGRRLVYKFGKNARGWRENEN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GAF-008-5 1 mL
Colloidal Gold Conjugated Goat Purified Antibody To Human Lambda Light Chain, 5nm
Sign In for Pricing
View Details 
K3160904 1.0 µg DNA
Aadacl2 sgRNA CRISPR Lentivector (Mouse) (Target 3)
Sign In for Pricing
View Details TRV-0061617-01 20 µL
Monoclonal Antibody to Myxovirus Resistance 2 (MX2)
Sign In for Pricing
View Details TRV-0061617-02 100 µL
Monoclonal Antibody to Myxovirus Resistance 2 (MX2)
Sign In for Pricing
View Details