Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EHF Peptide - C-terminal region

EHF Peptide - C-terminal region

Product Specifications

Product Name Alternative

AU019492, 9030625L19Rik

UniProt

O70273

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_031940.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KKKNNSSMTYEKLSRAMRYYYKREILERVDGRRLVYKFGKNARGWRENEN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C10orf96 Rabbit Polyclonal Antibody (AP)
orb956743 100 µL

C10orf96 Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
BTAF1 ORF Vector (Human) (pORF)
ORF012349 1.0 µg DNA

BTAF1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Renin (A-1) HRP
sc-137252 HRP 200 µg/mL

Renin (A-1) HRP

Sign In for Pricing
View Details
GAL3ST4 CytoSection
TS403401P5 25 Slides

GAL3ST4 CytoSection

Sign In for Pricing
View Details
C6orf142 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0248306 1.0 µg DNA

C6orf142 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
RBMX2 Rabbit Polyclonal Antibody (Cy5.5)
orb1062655 100 µL

RBMX2 Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details