Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANGPT1 Peptide - middlel region

ANGPT1 Peptide - middlel region

Product Specifications

Product Name Alternative

Ang1, Ang-1, 1110046O21Rik

UniProt

O08538

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_033770.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHTGT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 10 (LH2), CF647 conjugate, 0.1mg/mL
BNC470674-100 1x 100 µL

Cytokeratin 10 (LH2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FRMD4B Human Gene Knockout Kit (CRISPR)
KN414859 1 Kit

FRMD4B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NGLY1 (NM_001145293) Human Over-expression Lysate
LY428797 100 µg

NGLY1 (NM_001145293) Human Over-expression Lysate

Sign In for Pricing
View Details
Nitrate Reductase Microplate Assay Kit
RDSM014 100 Assays

Nitrate Reductase Microplate Assay Kit

Sign In for Pricing
View Details
KIF11/Eg5 (Ab-927) Antibody
8B1081-AAT 50 µg

KIF11/Eg5 (Ab-927) Antibody

Sign In for Pricing
View Details
PPIA Rabbit Monoclonal Antibody [Clone ID: 24GB905]
TA425055 100 µL

PPIA Rabbit Monoclonal Antibody [Clone ID: 24GB905]

Sign In for Pricing
View Details