Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANGPT1 Peptide - middlel region

ANGPT1 Peptide - middlel region

Product Specifications

Product Name Alternative

Ang1, Ang-1, 1110046O21Rik

UniProt

O08538

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_033770.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHTGT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GSTM3 (NM_000849) Human Over-expression Lysate
LC424491 20 µg

GSTM3 (NM_000849) Human Over-expression Lysate

Sign In for Pricing
View Details
RET Mouse Monoclonal Antibody [Clone ID: OTI21H4]
CF805811 100 µg

RET Mouse Monoclonal Antibody [Clone ID: OTI21H4]

Sign In for Pricing
View Details
Human EGFR, C-His Tag
HA211104-01 20 µg

Human EGFR, C-His Tag

Sign In for Pricing
View Details
Human EGFR, C-His Tag
HA211104-02 50 µg

Human EGFR, C-His Tag

Sign In for Pricing
View Details
Human EGFR, C-His Tag
HA211104-03 100 µg

Human EGFR, C-His Tag

Sign In for Pricing
View Details
Human IgD (Immunoglobulin Delta Heavy Chain) (B-Cell Marker) (IGHD/2730R), CF405S conjugate, 0.1mg/mL
BNC042730-100 1x 100 µL

Human IgD (Immunoglobulin Delta Heavy Chain) (B-Cell Marker) (IGHD/2730R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details