Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLF1 Peptide - C-terminal region

KLF1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

9830124P08Rik

UniProt

Q99JB0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KAHLRTHTGEKPYACSWDGCDWRFARSDELTRHYRKHTGHRPFCCGLCPR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2807), 0.2mg/mL
BNUB2807-100 1x 100 µL

Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2807), 0.2mg/mL

Sign In for Pricing
View Details
FCRLB Mouse Monoclonal Antibody [Clone ID: OTI4G1]
CF809247 100 µg

FCRLB Mouse Monoclonal Antibody [Clone ID: OTI4G1]

Sign In for Pricing
View Details
6-OG488 succinimidyl ester [equivalent to Oregon Green® 488 carboxylic acid, succinimidyl ester, 6-isomer ]
711-AAT 5 mg

6-OG488 succinimidyl ester [equivalent to Oregon Green® 488 carboxylic acid, succinimidyl ester, 6-isomer ]

Sign In for Pricing
View Details
HLA Class II DR Mouse Monoclonal Antibody [Clone ID: BRA30]
AM39032RP-N 100 Tests

HLA Class II DR Mouse Monoclonal Antibody [Clone ID: BRA30]

Sign In for Pricing
View Details
Frozen Tissue Blocks, Colon
CB513926 1 Block

Frozen Tissue Blocks, Colon

Sign In for Pricing
View Details
LARS2 Antibody
KC-33195-01 50 μL

LARS2 Antibody

Sign In for Pricing
View Details