Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXB7 Peptide - middlel region

HOXB7 Peptide - middlel region

Product Specifications

Product Name Alternative

Hox-2.3, AI325018

UniProt

P09024

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_034590.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LELEKEFHYNRYLTRRRRIEIAHTLCLTERQIKIWFQNRRMKWKKENKTS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RT-LAMP pH Sensitive Dyestuff Kit (UDG plus) Colorimetric
13906ES80 1000 Tests

RT-LAMP pH Sensitive Dyestuff Kit (UDG plus) Colorimetric

Sign In for Pricing
View Details
PAPP-A / Pappalysin-1 (Marker of Atherosclerosis and Aneuploid Fetus) (PAPPA/2718), CF405S conjugate, 0.1mg/mL
BNC042718-100 1x 100 µL

PAPP-A / Pappalysin-1 (Marker of Atherosclerosis and Aneuploid Fetus) (PAPPA/2718), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Forced Convection Oven BOFC-5404
BOFC-5404 1 Unit

Forced Convection Oven BOFC-5404

Sign In for Pricing
View Details
TTC39B (NM_152574) Human Recombinant Protein
TP323149L 1 mg

TTC39B (NM_152574) Human Recombinant Protein

Sign In for Pricing
View Details
EIF4EBP1 pThr46 Rabbit Polyclonal Antibody
AP20835PU-N 100 µg

EIF4EBP1 pThr46 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
JDP2 (NM_001135048) Human Over-expression Lysate
LC427535 20 µg

JDP2 (NM_001135048) Human Over-expression Lysate

Sign In for Pricing
View Details