Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC26A4 Peptide - middlel region

SLC26A4 Peptide - middlel region

Product Specifications

Product Name Alternative

Pds, pendrin

UniProt

Q9R155

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_035997.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NVFSGFFSCFVATTALSRTAVQESTGGKTQVAGLISAVIVMVAIVALGRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS24 (1-130, His-tag) Human Protein
AR51033PU-S 20 µg

RPS24 (1-130, His-tag) Human Protein

Sign In for Pricing
View Details
Lymphoma SV Panel
PH2001700-01 4 Reactions

Lymphoma SV Panel

Sign In for Pricing
View Details
Lymphoma SV Panel
PH2001700-02 4 Reactions

Lymphoma SV Panel

Sign In for Pricing
View Details
FAM13A Protein Vector (Human) (pPB-C-His)
PV015169 500 ng

FAM13A Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
LAMC2 Recombinant Protein
OPCD04825-200UG 200 µg

LAMC2 Recombinant Protein

Sign In for Pricing
View Details
C7orf50 Protein Vector (Human) (pPB-N-His)
PV006854 500 ng

C7orf50 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details