Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC26A4 Peptide - middlel region

SLC26A4 Peptide - middlel region

Product Specifications

Product Name Alternative

Pds, pendrin

UniProt

Q9R155

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_035997.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NVFSGFFSCFVATTALSRTAVQESTGGKTQVAGLISAVIVMVAIVALGRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Rint1 (NM_177323) AAV Particle
MR210682A1V 250 µL

Mouse Rint1 (NM_177323) AAV Particle

Sign In for Pricing
View Details
Goat anti-CD3E (cytoplasmic) Antibody
MBS423329-01 0.1 mg

Goat anti-CD3E (cytoplasmic) Antibody

Sign In for Pricing
View Details
Goat anti-CD3E (cytoplasmic) Antibody
MBS423329-02 5x 0.1 mg

Goat anti-CD3E (cytoplasmic) Antibody

Sign In for Pricing
View Details
anti-PPAR gamma
YF-PA24433 50 ul

anti-PPAR gamma

Sign In for Pricing
View Details
Olfr1302 Protein Vector (Mouse) (pPM-C-HA)
32757024 500 ng

Olfr1302 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
GEMI8 Polyclonal Antibody
BT-AP15729-01 20 µL

GEMI8 Polyclonal Antibody

Sign In for Pricing
View Details