ACAT1 Peptide - middlel region
ACAT1 Peptide - middlel region
Product Specifications
Product Name Alternative
Acat, 6330585C21Rik
UniProt
Q8QZT1
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_659033.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KEAWDAGKFASEITPITISVKGKPDVVVKEDEEYKRVDFSKVPKLKTVFQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
bs-8418R-BF555 100 µL
HEXDC Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
Sign In for Pricing
View Details 
MBS2050159-01 0.1 mL
HRP-Linked Polyclonal Antibody to Cyclophilin A (CYPA)
Sign In for Pricing
View Details MBS2050159-02 0.2 mL
HRP-Linked Polyclonal Antibody to Cyclophilin A (CYPA)
Sign In for Pricing
View Details MBS2050159-03 0.5 mL
HRP-Linked Polyclonal Antibody to Cyclophilin A (CYPA)
Sign In for Pricing
View Details MBS2050159-04 1 mL
HRP-Linked Polyclonal Antibody to Cyclophilin A (CYPA)
Sign In for Pricing
View Details