What is the catalog number for ACAT1 Peptide - middlel region?

The catalog number for ACAT1 Peptide - middlel region is orb1997662.

What sizes are available for ACAT1 Peptide - middlel region?

ACAT1 Peptide - middlel region is available in the following size(s): 100 µg.

Is ACAT1 Peptide - middlel region in stock?

ACAT1 Peptide - middlel region is currently made to order / not held in immediate stock. Contact us for lead time.

ACAT1 Peptide - middlel region

Product Specifications

Product Name Alternative

Acat, 6330585C21Rik

UniProt

Q8QZT1

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_659033.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KEAWDAGKFASEITPITISVKGKPDVVVKEDEEYKRVDFSKVPKLKTVFQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TR312763 1 Kit

GJB6 Human shRNA Plasmid Kit (Locus ID 10804)

Sign In for Pricing

View Details

NBP2-34760IR 0.1 mL

Mouse Monoclonal alpha-Smooth Muscle Actin Antibody (SPM332) [DyLight 755]

Sign In for Pricing

View Details

MBS9616785-01 1 mg

CYLD Blocking Peptide

Sign In for Pricing

View Details

MBS9616785-02 5x 1 mg

CYLD Blocking Peptide

Sign In for Pricing

View Details

TRC-C256650-50MG 50 mg

CEP-28122

Sign In for Pricing

View Details

22940064 1.0 µg DNA

H2-T22 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing

View Details