PDIA3 Peptide - middlel region
PDIA3 Peptide - middlel region
Product Specifications
Product Name Alternative
Erp, PDI, Plca, 58kDa, ERp57, ERp60, ERp61, Grp58, PDI-Q2, PI-PLC, PLC[a]
UniProt
P27773
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_031978.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LEPKYKELGEKLSKDPNIVIAKMDATANDVPSPYEVKGFPTIYFSPANKK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
SYP-H0013-01 48 Well
Human MCP-3(Monocyte Chemotactic Protein 3) ELISA Kit
Sign In for Pricing
View Details SYP-H0013-02 96 Well
Human MCP-3(Monocyte Chemotactic Protein 3) ELISA Kit
Sign In for Pricing
View Details