Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDIA3 Peptide - middlel region

PDIA3 Peptide - middlel region

Product Specifications

Product Name Alternative

Erp, PDI, Plca, 58kDa, ERp57, ERp60, ERp61, Grp58, PDI-Q2, PI-PLC, PLC[a]

UniProt

P27773

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_031978.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LEPKYKELGEKLSKDPNIVIAKMDATANDVPSPYEVKGFPTIYFSPANKK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethyl 8-bromoquinoline-3-carboxylate
OR1004535 1 g

Ethyl 8-bromoquinoline-3-carboxylate

Sign In for Pricing
View Details
ECHDC3 siRNA (Human)
MBS8203453-01 15 nmol

ECHDC3 siRNA (Human)

Sign In for Pricing
View Details
ECHDC3 siRNA (Human)
MBS8203453-02 30 nmol

ECHDC3 siRNA (Human)

Sign In for Pricing
View Details
ECHDC3 siRNA (Human)
MBS8203453-03 5x 30 nmol

ECHDC3 siRNA (Human)

Sign In for Pricing
View Details
MRF/C11orf9 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-11191R-BF594-TR 20 µL

MRF/C11orf9 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Rat Urotensin 2 Receptor (UTS2R) ELISA Kit
abx156213-01 96 Tests

Rat Urotensin 2 Receptor (UTS2R) ELISA Kit

Sign In for Pricing
View Details