Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ENO2 Peptide - middlel region

ENO2 Peptide - middlel region

Product Specifications

Product Name Alternative

NSE, Eno-2, AI837106, D6Ertd375e

UniProt

P17183

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001289571.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DAMRLGAEVYHTLKGVIKDKYGKDATNVGDEGGFAPNILENSEALELVKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hi-FlexiLoop 2
PW012S-1X100NO 1 unit

Hi-FlexiLoop 2

Sign In for Pricing
View Details
mTOR Antibody: HRP
MBS8001808-01 0.1 mg

mTOR Antibody: HRP

Sign In for Pricing
View Details
mTOR Antibody: HRP
MBS8001808-02 5x 0.1 mg

mTOR Antibody: HRP

Sign In for Pricing
View Details
Mouse Monoclonal Reg1 Antibody (5F8)
H00005967-M17-100ug 100 µg

Mouse Monoclonal Reg1 Antibody (5F8)

Sign In for Pricing
View Details
CD84 Rabbit mAb
E45R11477N 50 ul

CD84 Rabbit mAb

Sign In for Pricing
View Details
Monkey IgG / Cy3
orb1610950 100 µL

Monkey IgG / Cy3

Sign In for Pricing
View Details