Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACO2 Peptide - middlel region

ACO2 Peptide - middlel region

Product Specifications

Product Name Alternative

Aco3, Aco-2, D10Wsu183e

UniProt

Q99KI0

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_542364.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KFKLEAPDADELPRSDFDPGQDTYQHPPKDSSGQRVDVSPTSQRLQLLEP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Suz12 Mouse Gene Knockout Kit (CRISPR)
KN517009 1 Kit

Suz12 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mettl4 Mouse Gene Knockout Kit (CRISPR)
KN310008LP 1 Kit

Mettl4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SnoN (SKIL) Rabbit Polyclonal Antibody
TA381523 100 µL

SnoN (SKIL) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Endometrium
CR559231 5 µg

Tissue Total RNA, Endometrium

Sign In for Pricing
View Details
GPR124 (ADGRA2) (NM_032777) Human Over-expression Lysate
LC432439 20 µg

GPR124 (ADGRA2) (NM_032777) Human Over-expression Lysate

Sign In for Pricing
View Details
CD27 (Tumor Necrosis Factor Receptor Superfamily 7) (LPFS2/2034R), CF647 conjugate, 0.1mg/mL
BNC472034-500 1x 500 µL

CD27 (Tumor Necrosis Factor Receptor Superfamily 7) (LPFS2/2034R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details