Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACO2 Peptide - middlel region

ACO2 Peptide - middlel region

Product Specifications

Product Name Alternative

Aco3, Aco-2, D10Wsu183e

UniProt

Q99KI0

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_542364.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KFKLEAPDADELPRSDFDPGQDTYQHPPKDSSGQRVDVSPTSQRLQLLEP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human C9orf47 activation kit by CRISPRa
GA117286 1 Kit

Human C9orf47 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Human LMAN2L Protein (His Tag)
PKSH033213-01 10 µg

Recombinant Human LMAN2L Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human LMAN2L Protein (His Tag)
PKSH033213-02 50 µg

Recombinant Human LMAN2L Protein (His Tag)

Sign In for Pricing
View Details
Mouse Ambp activation kit by CRISPRa
GA200176 1 Kit

Mouse Ambp activation kit by CRISPRa

Sign In for Pricing
View Details
Fabp9 (NM_011598) Mouse Tagged ORF Clone
MG200770 10 µg

Fabp9 (NM_011598) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
HSPA6 (NM_002155) Human Recombinant Protein
TP307795M 100 µg

HSPA6 (NM_002155) Human Recombinant Protein

Sign In for Pricing
View Details