Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPFIBP1 Peptide - N-terminal region

PPFIBP1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

L2, SGT2, hSGT2, hSgt2p

UniProt

Q86W92

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PPFIBP1 Rabbit Polyclonal Antibody (orb578351) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_003613

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TLVEWLQSQMTNGHLPGNGDVYQERLARLENDKESLVLQVSVLTDQVEAQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Tmem45a2 activation kit by CRISPRa
GA208191 1 Kit

Mouse Tmem45a2 activation kit by CRISPRa

Sign In for Pricing
View Details
TMEM95 Human Gene Knockout Kit (CRISPR)
KN422524 1 Kit

TMEM95 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: sigmoid
CS513114 5x 5 µm

Frozen Tissue Sections, Colon: sigmoid

Sign In for Pricing
View Details
BCL10 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4H9]
TA800445AM 100 µL

BCL10 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4H9]

Sign In for Pricing
View Details
P3H3 Human Gene Knockout Kit (CRISPR)
KN415599 1 Kit

P3H3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Anti-H+ATPase | Plasma membrane H+ATPase (rabbit antibody), DyLight® 488 conjugated (40 µg)
AS07 260-DL488 40 µg

Anti-H+ATPase | Plasma membrane H+ATPase (rabbit antibody), DyLight® 488 conjugated (40 µg)

Sign In for Pricing
View Details