PPFIBP1 Peptide - N-terminal region
PPFIBP1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
L2, SGT2, hSGT2, hSgt2p
UniProt
Q86W92
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PPFIBP1 Rabbit Polyclonal Antibody (orb578351) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_003613
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TLVEWLQSQMTNGHLPGNGDVYQERLARLENDKESLVLQVSVLTDQVEAQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MS-NOR-3001 1 Unit
MS Orbital anti-moistured shaker with 30 x 30 cm platform and flat non-slip rubber mat
Sign In for Pricing
View Details 
GM-204-10 1 mL
Colloidal Gold Conjugated Monoclonal Antibody to Human IgG3 HP6047, 10nm
Sign In for Pricing
View Details