Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP2A1 Peptide - middle region

ATP2A1 Peptide - middle region

Product Specifications

Product Name Alternative

ATP2A, SERCA1

UniProt

O14983

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ATP2A1 Rabbit Polyclonal Antibody (orb578368) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_004311

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IFGENEEVADRAYTGREFDDLPLAEQREACRRACCFARVEPSHKSKIVEY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Plekhb2 (BC057994) Mouse Tagged ORF Clone
MG202046 10 µg

Plekhb2 (BC057994) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Hydroxylamine-d3 Hydrochloride-d
TRC-H943709-5G 5 g

Hydroxylamine-d3 Hydrochloride-d

Sign In for Pricing
View Details
4-Benzylcyclohexan-1-one
TRC-B536908-5MG 5 mg

4-Benzylcyclohexan-1-one

Sign In for Pricing
View Details
Recombinant BTK Antibody
RC-15449-01 50 μL

Recombinant BTK Antibody

Sign In for Pricing
View Details
Recombinant BTK Antibody
RC-15449-02 100 µL

Recombinant BTK Antibody

Sign In for Pricing
View Details
Recombinant BTK Antibody
RC-15449-03 1 mL

Recombinant BTK Antibody

Sign In for Pricing
View Details