Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP2A1 Peptide - middle region

ATP2A1 Peptide - middle region

Product Specifications

Product Name Alternative

ATP2A, SERCA1

UniProt

O14983

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ATP2A1 Rabbit Polyclonal Antibody (orb578368) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_004311

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IFGENEEVADRAYTGREFDDLPLAEQREACRRACCFARVEPSHKSKIVEY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CBFB (NM_001755) Human Over-expression Lysate
LY400665 100 µg

CBFB (NM_001755) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue Total RNA, Lung
CR562937 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details
Frozen Tissue Blocks, Breast
CB633668 1 Block

Frozen Tissue Blocks, Breast

Sign In for Pricing
View Details
CD14 (Monocyte / Macrophage Marker) (LPSR/2386), CF488A conjugate, 0.1mg/mL
BNC882386-100 1x 100 µL

CD14 (Monocyte / Macrophage Marker) (LPSR/2386), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TBXAS1 (NM_001061) Human Recombinant Protein
TP308028 20 µg

TBXAS1 (NM_001061) Human Recombinant Protein

Sign In for Pricing
View Details
Mix-n-StainTM CF®568 Antibody Labeling Kit, 1x (20-50ug) labeling
#92255 1 Kit

Mix-n-StainTM CF®568 Antibody Labeling Kit, 1x (20-50ug) labeling

Sign In for Pricing
View Details