Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHLPP2 Peptide - C-terminal region

PHLPP2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PHLPPL

UniProt

Q6ZVD8

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PHLPP2 Rabbit Polyclonal Antibody (orb578470) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_055835

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PVPLSKVFSLEQDPEEAQRVKDQKAIITEDNKVNGVTCCTRMLGCTYLYP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAPPA Antibody
OACD06291-1ML 1 mL

PAPPA Antibody

Sign In for Pricing
View Details
PADI2 Mouse Monoclonal Antibody
AMM83231-01 1 Each

PADI2 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
PADI2 Mouse Monoclonal Antibody
AMM83231-02 50 µL

PADI2 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
PADI2 Mouse Monoclonal Antibody
AMM83231-03 100 µL

PADI2 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Sheep Papiloma Virus Antibody (Anti-PV) ELISA Kit
OM617627 96 Strip Well

Sheep Papiloma Virus Antibody (Anti-PV) ELISA Kit

Sign In for Pricing
View Details
Hsd17b13 (NM_001009684) Rat Tagged Lenti ORF Clone
RR206057L3 10 µg

Hsd17b13 (NM_001009684) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details