Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHLPP2 Peptide - C-terminal region

PHLPP2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PHLPPL

UniProt

Q6ZVD8

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PHLPP2 Rabbit Polyclonal Antibody (orb578470) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_055835

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PVPLSKVFSLEQDPEEAQRVKDQKAIITEDNKVNGVTCCTRMLGCTYLYP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRGPRD sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1324108 1.0 µg DNA

MRGPRD sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Urine microRNA Purification Kit
29000 25 Preparations

Urine microRNA Purification Kit

Sign In for Pricing
View Details
Mesothelin (MSLN) Mouse Monoclonal Antibody [Clone ID: OTI1A6]
TA805260S 30 µL

Mesothelin (MSLN) Mouse Monoclonal Antibody [Clone ID: OTI1A6]

Sign In for Pricing
View Details
FXYD6P2 Protein Vector (Human) (pPM-C-HA)
21099021 500 ng

FXYD6P2 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
ARIH2 Mouse Monoclonal Antibody [Clone ID: LBI7D5]
AMM20539V 100 µL

ARIH2 Mouse Monoclonal Antibody [Clone ID: LBI7D5]

Sign In for Pricing
View Details
Recombinant C. trachomatis MOMP (strain SA1/OT / Serovar A) [His]
DAGA-3065 100ug

Recombinant C. trachomatis MOMP (strain SA1/OT / Serovar A) [His]

Sign In for Pricing
View Details