Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TJP3 Peptide - middle region

TJP3 Peptide - middle region

Product Specifications

Product Name Alternative

ZO3, ZO-3

UniProt

O95049

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_055243

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GRDLREQERGIIPNQSRAEQLASLEAAQRAVGVGPGSSAGSNARAEFWRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IGFBP2 activation kit by CRISPRa
GA102354 1 Kit

Human IGFBP2 activation kit by CRISPRa

Sign In for Pricing
View Details
IgM Immunoglobulin (Cocktail), Biotin conjugate, 0.1mg/mL
BNCB0762-500 1x 500 µL

IgM Immunoglobulin (Cocktail), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PE/Cyanine7 Rat IgG2a, κ Isotype Control[2A3]
E-AB-F09833H-01 25 µg

PE/Cyanine7 Rat IgG2a, κ Isotype Control[2A3]

Sign In for Pricing
View Details
PE/Cyanine7 Rat IgG2a, κ Isotype Control[2A3]
E-AB-F09833H-02 100 µg

PE/Cyanine7 Rat IgG2a, κ Isotype Control[2A3]

Sign In for Pricing
View Details
Gastrin (GAST) Rabbit Polyclonal Antibody
TA364106 50 µL

Gastrin (GAST) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (N/A), CF568 conjugate, 0.1mg/mL
BNC681776-100 1x 100 µL

CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (N/A), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details