Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TJP3 Peptide - middle region

TJP3 Peptide - middle region

Product Specifications

Product Name Alternative

ZO3, ZO-3

UniProt

O95049

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_055243

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GRDLREQERGIIPNQSRAEQLASLEAAQRAVGVGPGSSAGSNARAEFWRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Kappa Light Chain (HP6053 + L1C1), CF647 conjugate, 0.1mg/mL
BNC470755-100 1x 100 µL

Human Kappa Light Chain (HP6053 + L1C1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Omentum
CS701130 5x 5 µm

Tissue FFPE Sections, Omentum

Sign In for Pricing
View Details
TCF23 Human Gene Knockout Kit (CRISPR)
KN421910 1 Kit

TCF23 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Monoclonal Antibody -IgG subtype Isotyping Kit
IC-IS-002-20 1 Each

Mouse Monoclonal Antibody -IgG subtype Isotyping Kit

Sign In for Pricing
View Details
SLC5A11 Human Gene Knockout Kit (CRISPR)
KN415877 1 Kit

SLC5A11 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SLC1A4 Antibody
KC-3367-01 50 μL

SLC1A4 Antibody

Sign In for Pricing
View Details