DZIP3 Peptide - C-terminal region
DZIP3 Peptide - C-terminal region
Product Specifications
Product Name Alternative
UURF2, PPP1R66, hRUL138
UniProt
Q86Y13
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DZIP3 Rabbit Polyclonal Antibody (orb578744) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_055463
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NLSVLPCAHKFHAQCIRPWLMQQGTCPTCRLHVLLPEEFPGHPSRQLPKI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
107110U1-AAT 500 Tests
MFluor™ Green 620 Anti-human CD71 Antibody *HI166*
Sign In for Pricing
View Details MBS009262 Inquire
Rabbit Fc Fragment of IgG Low Affinity IIIb Receptor ELISA Kit
Sign In for Pricing
View Details 
PC109764 250 mg
1- (6-Chloro-4-trifluoromethyl-pyridin-2-yl) -1H-pyrazole-4-carboxylic acid dimethylamide
Sign In for Pricing
View Details 