Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DZIP3 Peptide - C-terminal region

DZIP3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

UURF2, PPP1R66, hRUL138

UniProt

Q86Y13

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DZIP3 Rabbit Polyclonal Antibody (orb578744) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_055463

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NLSVLPCAHKFHAQCIRPWLMQQGTCPTCRLHVLLPEEFPGHPSRQLPKI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSPAN20 Rabbit pAb, IRDye 800CW conjugated
orb2863646 100 µL

TSPAN20 Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details
PDIA6, ID (K159) (Protein Disulfide-isomerase A6, Protein Disulfide Isomerase P5, Thioredoxin Domain-containing Protein 7, Endoplasmic Reticulum Protein 5, ER Protein 5, ERp5, TXNDC7, PDIA6)
MBS625608-01 0.2 mL

PDIA6, ID (K159) (Protein Disulfide-isomerase A6, Protein Disulfide Isomerase P5, Thioredoxin Domain-containing Protein 7, Endoplasmic Reticulum Protein 5, ER Protein 5, ERp5, TXNDC7, PDIA6)

Sign In for Pricing
View Details
PDIA6, ID (K159) (Protein Disulfide-isomerase A6, Protein Disulfide Isomerase P5, Thioredoxin Domain-containing Protein 7, Endoplasmic Reticulum Protein 5, ER Protein 5, ERp5, TXNDC7, PDIA6)
MBS625608-02 5x 0.2 mL

PDIA6, ID (K159) (Protein Disulfide-isomerase A6, Protein Disulfide Isomerase P5, Thioredoxin Domain-containing Protein 7, Endoplasmic Reticulum Protein 5, ER Protein 5, ERp5, TXNDC7, PDIA6)

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS806542 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
MUC1 Mouse mAb
MBS4753925-01 0.1 mL

MUC1 Mouse mAb

Sign In for Pricing
View Details
MUC1 Mouse mAb
MBS4753925-02 5x 0.1 mL

MUC1 Mouse mAb

Sign In for Pricing
View Details