TPO Peptide - C-terminal region
TPO Peptide - C-terminal region
Product Specifications
Product Name Alternative
MSA, TPX, TDH2A
UniProt
P07202
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TPO Rabbit Polyclonal Antibody (orb579131) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_000538
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VQDQLMNEELTERLFVLSNSSTLDLASINLQRGRDHGLPGYNEWREFCGL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC471820-100 1x 100 µL
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042848-500 1x 500 µL
Fibronectin (Fn-3), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400029-500 1x 500 µL
Fibronectin (TV-1), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042056-100 1x 100 µL
CD7 (T-Cell Leukemia Marker) (CD7/3737), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940028-500 1x 500 µL
CD45RA (158-4D3), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680908-500 1x 500 µL
Tyrosinase (T311 + OCA1/812), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details