Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KTN1 Peptide - middle region

KTN1 Peptide - middle region

Product Specifications

Product Name Alternative

CG1, KNT, MU-RMS-40.19

UniProt

Q86UP2

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KTN1 Rabbit Polyclonal Antibody (orb579366) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001072990

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VQLSITSKVQELQNLLKGKEEQMNTMKAVLEEKEKDLANTGKWLQDLQEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse monoclonal HBsAg antibody (biotin-conjugated)
MBS5304739-01 1 mL

Mouse monoclonal HBsAg antibody (biotin-conjugated)

Sign In for Pricing
View Details
Mouse monoclonal HBsAg antibody (biotin-conjugated)
MBS5304739-02 5x 1 mL

Mouse monoclonal HBsAg antibody (biotin-conjugated)

Sign In for Pricing
View Details
LOC100505046 3'UTR Luciferase Stable Cell Line
TU112243 1.0 mL

LOC100505046 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
HHV-4 BSLF2 Antibody
251350 0.1 mg

HHV-4 BSLF2 Antibody

Sign In for Pricing
View Details
CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (CFTR/2290R), CF740 conjugate, 0.1mg/mL
BNC742290-500 1x 500 µL

CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (CFTR/2290R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSV-1; Clone rHSV1/1934 (Concentrate)
RA0688-C.1 0.1 mL

HSV-1; Clone rHSV1/1934 (Concentrate)

Sign In for Pricing
View Details