Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KTN1 Peptide - middle region

KTN1 Peptide - middle region

Product Specifications

Product Name Alternative

CG1, KNT, MU-RMS-40.19

UniProt

Q86UP2

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KTN1 Rabbit Polyclonal Antibody (orb579366) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001072990

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VQLSITSKVQELQNLLKGKEEQMNTMKAVLEEKEKDLANTGKWLQDLQEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal MAP7D2 Antibody
NBP2-14740 0.1 mL

Rabbit Polyclonal MAP7D2 Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal PSMD13 Antibody
NBP2-95231-0.1mL 0.1 mL

Rabbit Polyclonal PSMD13 Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal PDK-1 Antibody [Alexa Fluor 532]
NB100-2384AF532 0.1 mL

Rabbit Polyclonal PDK-1 Antibody [Alexa Fluor 532]

Sign In for Pricing
View Details
TATA-Box-Binding Protein (TBP) Antibody
abx403636-01 100 µL

TATA-Box-Binding Protein (TBP) Antibody

Sign In for Pricing
View Details
TATA-Box-Binding Protein (TBP) Antibody
abx403636-02 200 µL

TATA-Box-Binding Protein (TBP) Antibody

Sign In for Pricing
View Details
TATA-Box-Binding Protein (TBP) Antibody
abx403636-03 1 mL

TATA-Box-Binding Protein (TBP) Antibody

Sign In for Pricing
View Details