Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPATA5 Peptide - C-terminal region

SPATA5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AFG2, SPAF, EHLMRS

UniProt

Q8NB90

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPATA5 Rabbit Polyclonal Antibody (orb581844) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_660208

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LPLKQPELFKSYGIPAPRGVLLYGPPGTGKTMIARAVANEVGAYVSVING

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Fluoroephedrone Hydrochloride
TRC-F591580-5MG 5 mg

4-Fluoroephedrone Hydrochloride

Sign In for Pricing
View Details
PAX5 / BSAP (Early B-Cell Marker) (PCRP-PAX5-1B7), CF740 conjugate, 0.1mg/mL
BNC741908-100 1x 100 µL

PAX5 / BSAP (Early B-Cell Marker) (PCRP-PAX5-1B7), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2-Phenylethyl D-rutinoside
TRC-P930645-50MG 50 mg

2-Phenylethyl D-rutinoside

Sign In for Pricing
View Details
FABP2 (NM_000134) Human Recombinant Protein
TP720115 10 µg

FABP2 (NM_000134) Human Recombinant Protein

Sign In for Pricing
View Details
Bmyc Mouse Gene Knockout Kit (CRISPR)
KN502209 1 Kit

Bmyc Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MRPL18 Antibody
8C14062-AAT 50 µg

MRPL18 Antibody

Sign In for Pricing
View Details