Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VARS Peptide - middle region

VARS Peptide - middle region

Product Specifications

Product Name Alternative

G7a, Bat6, Vars2, D17H6S56E

UniProt

Q9Z1Q9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_035820.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HRIPAYFITVHDPAVPPGEDPDGRYWVSGRTEAEAREKAAREFGVSPDKI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adrenomedullin (11-50) (rat)
H-5694.0500 0.5mg

Adrenomedullin (11-50) (rat)

Sign In for Pricing
View Details
Human Family With Sequence Similarity 20, Member A (FAM20A) ELISA Kit
MBS2706850-01 24 Strip Well

Human Family With Sequence Similarity 20, Member A (FAM20A) ELISA Kit

Sign In for Pricing
View Details
Human Family With Sequence Similarity 20, Member A (FAM20A) ELISA Kit
MBS2706850-02 48 Well

Human Family With Sequence Similarity 20, Member A (FAM20A) ELISA Kit

Sign In for Pricing
View Details
Human Family With Sequence Similarity 20, Member A (FAM20A) ELISA Kit
MBS2706850-03 96 Well

Human Family With Sequence Similarity 20, Member A (FAM20A) ELISA Kit

Sign In for Pricing
View Details
Human Family With Sequence Similarity 20, Member A (FAM20A) ELISA Kit
MBS2706850-04 5x 96 Well

Human Family With Sequence Similarity 20, Member A (FAM20A) ELISA Kit

Sign In for Pricing
View Details
Human Family With Sequence Similarity 20, Member A (FAM20A) ELISA Kit
MBS2706850-05 10x 96 Well

Human Family With Sequence Similarity 20, Member A (FAM20A) ELISA Kit

Sign In for Pricing
View Details