Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VARS Peptide - middle region

VARS Peptide - middle region

Product Specifications

Product Name Alternative

G7a, Bat6, Vars2, D17H6S56E

UniProt

Q9Z1Q9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_035820.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HRIPAYFITVHDPAVPPGEDPDGRYWVSGRTEAEAREKAAREFGVSPDKI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL21R Rabbit Polyclonal Antibody (PE-Cy5.5)
orb906476 100 µL

IL21R Rabbit Polyclonal Antibody (PE-Cy5.5)

Sign In for Pricing
View Details
CHCHD6 Antibody
orb2809288 100 µL

CHCHD6 Antibody

Sign In for Pricing
View Details
FBLN1 (Fibulin 1, FBLN, Fibulin-1, FIBL-1, PP213) (MaxLight 405) discontinued
126647-ML405 100 µL

FBLN1 (Fibulin 1, FBLN, Fibulin-1, FIBL-1, PP213) (MaxLight 405) discontinued

Sign In for Pricing
View Details
N1-Methyl-3'-O- (2-methoxyethyl) adenosine
orb1908430-01 5 mg

N1-Methyl-3'-O- (2-methoxyethyl) adenosine

Sign In for Pricing
View Details
N1-Methyl-3'-O- (2-methoxyethyl) adenosine
orb1908430-02 10 mg

N1-Methyl-3'-O- (2-methoxyethyl) adenosine

Sign In for Pricing
View Details
N1-Methyl-3'-O- (2-methoxyethyl) adenosine
orb1908430-03 25 mg

N1-Methyl-3'-O- (2-methoxyethyl) adenosine

Sign In for Pricing
View Details