Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PARP2 Peptide - middle region

PARP2 Peptide - middle region

Product Specifications

Product Name Alternative

ARTD2, Adprt2, C78626, PARP-2, Adprtl2, Aspartl2

UniProt

O88554

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_033762.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QRNFSVWMRWGRVGKTGQHSLVTCSGDLNKAKEIFQKKFLDKTKNNWEDR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Alanine Aminotransferase (ALT) ELISA Kit
EIA05242m 1 Kit

Mouse Alanine Aminotransferase (ALT) ELISA Kit

Sign In for Pricing
View Details
DNAJC9 Rabbit Polyclonal Antibody (Biotin)
orb2094772 100 µL

DNAJC9 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
IP6K2 (E-3)
sc-390895 200 µg/mL

IP6K2 (E-3)

Sign In for Pricing
View Details
GNB1L antibody - C-terminal region
MBS3205779-01 0.1 mL

GNB1L antibody - C-terminal region

Sign In for Pricing
View Details
GNB1L antibody - C-terminal region
MBS3205779-02 5x 0.1 mL

GNB1L antibody - C-terminal region

Sign In for Pricing
View Details
LOC494224 Rat shRNA Plasmid (Locus ID 494224)
TR701242 1 Kit

LOC494224 Rat shRNA Plasmid (Locus ID 494224)

Sign In for Pricing
View Details