What is the catalog number for PARP2 Peptide - middle region?

The catalog number for PARP2 Peptide - middle region is orb1997633.

What sizes are available for PARP2 Peptide - middle region?

PARP2 Peptide - middle region is available in the following size(s): 100 µg.

Is PARP2 Peptide - middle region in stock?

PARP2 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

PARP2 Peptide - middle region

Product Specifications

Product Name Alternative

ARTD2, Adprt2, C78626, PARP-2, Adprtl2, Aspartl2

UniProt

O88554

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_033762.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QRNFSVWMRWGRVGKTGQHSLVTCSGDLNKAKEIFQKKFLDKTKNNWEDR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBP2-54425B 100 µL

Rabbit Monoclonal EpCAM/TROP1 Antibody (EGP40/1556R) [Biotin]

Sign In for Pricing

View Details

MBS1032643-01 0.02 mg (E-Coli)

Recombinant Pseudomonas stutzeri FMN reductase (NADH) RutF

Sign In for Pricing

View Details

MBS1032643-02 0.1 mg (E-Coli)

Recombinant Pseudomonas stutzeri FMN reductase (NADH) RutF

Sign In for Pricing

View Details

MBS1032643-03 0.02 mg (Yeast)

Recombinant Pseudomonas stutzeri FMN reductase (NADH) RutF

Sign In for Pricing

View Details

MBS1032643-04 0.1 mg (Yeast)

Recombinant Pseudomonas stutzeri FMN reductase (NADH) RutF

Sign In for Pricing

View Details

MBS1032643-05 0.02 mg (Baculovirus)

Recombinant Pseudomonas stutzeri FMN reductase (NADH) RutF

Sign In for Pricing

View Details