Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AK1 Peptide - middle region

AK1 Peptide - middle region

Product Specifications

Product Name Alternative

Ak-1, B430205N08Rik

UniProt

Q9R0Y5

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001185719.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MTQRLLKRGETSGRVDDNEETIKKRLETYYNATEPVISFYDKRGIVRKVN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ccnb3 Mouse Gene Knockout Kit (CRISPR)
KN502807 1 Kit

Ccnb3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DSC1 Polyclonal Antibody
E-AB-16387-01 20 µL

DSC1 Polyclonal Antibody

Sign In for Pricing
View Details
DSC1 Polyclonal Antibody
E-AB-16387-02 60 µL

DSC1 Polyclonal Antibody

Sign In for Pricing
View Details
DSC1 Polyclonal Antibody
E-AB-16387-03 120 µL

DSC1 Polyclonal Antibody

Sign In for Pricing
View Details
DSC1 Polyclonal Antibody
E-AB-16387-04 200 µL

DSC1 Polyclonal Antibody

Sign In for Pricing
View Details
Transfectamine™ 7000 siRNA Transfection Reagent
60025-AAT 1 mL

Transfectamine™ 7000 siRNA Transfection Reagent

Sign In for Pricing
View Details