Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AK1 Peptide - middle region

AK1 Peptide - middle region

Product Specifications

Product Name Alternative

Ak-1, B430205N08Rik

UniProt

Q9R0Y5

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001185719.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MTQRLLKRGETSGRVDDNEETIKKRLETYYNATEPVISFYDKRGIVRKVN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNASEH2C Antibody
KC-42359-01 50 μL

RNASEH2C Antibody

Sign In for Pricing
View Details
RNASEH2C Antibody
KC-42359-02 100 µL

RNASEH2C Antibody

Sign In for Pricing
View Details
RNASEH2C Antibody
KC-42359-03 1 mL

RNASEH2C Antibody

Sign In for Pricing
View Details
Diisononyl Phthalate
TRC-D455225-50MG 50 mg

Diisononyl Phthalate

Sign In for Pricing
View Details
CT45A1 (NM_001017417) Human Recombinant Protein
TP314947 20 µg

CT45A1 (NM_001017417) Human Recombinant Protein

Sign In for Pricing
View Details
100mM dNTP Set, dATP, dGTP, dTTP, dCTP, 250µl /25µmol of each
PR3101-S-1 1 Each

100mM dNTP Set, dATP, dGTP, dTTP, dCTP, 250µl /25µmol of each

Sign In for Pricing
View Details