Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FXN Peptide - middle region

FXN Peptide - middle region

Product Specifications

Product Name Alternative

FA, X25, FARR, Frda

UniProt

O35943

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_032070.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VLTIKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIM3 / HAVCR2 / CD366 (Effector T-Cell Marker) (TIM3/3113), CF568 conjugate, 0.1mg/mL
BNC683113-500 1x 500 µL

TIM3 / HAVCR2 / CD366 (Effector T-Cell Marker) (TIM3/3113), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS504755 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Deacetyl Racecadotril Disulfide
TRC-D199020-50MG 50 mg

Deacetyl Racecadotril Disulfide

Sign In for Pricing
View Details
Tissue Total RNA, Colon: right
CR560510 5 µg

Tissue Total RNA, Colon: right

Sign In for Pricing
View Details
Human NXF2 activation kit by CRISPRa
GA111086 1 Kit

Human NXF2 activation kit by CRISPRa

Sign In for Pricing
View Details
SATB1 Human Gene Knockout Kit (CRISPR)
KN200421RB 1 Kit

SATB1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details