Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FXN Peptide - middle region

FXN Peptide - middle region

Product Specifications

Product Name Alternative

FA, X25, FARR, Frda

UniProt

O35943

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_032070.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VLTIKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1orf227 (SPATA45) (NM_001024601) Human Over-expression Lysate
LC422517 20 µg

C1orf227 (SPATA45) (NM_001024601) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Endometriotic tissue
CS502551 5x 5 µm

Frozen Tissue Sections, Endometriotic tissue

Sign In for Pricing
View Details
MET Rabbit Polyclonal Antibody
AP09516PU-S 50 µL

MET Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
U2AF1L3 (U2AF1L4) (NM_001040425) Human Over-expression Lysate
LC421747 20 µg

U2AF1L3 (U2AF1L4) (NM_001040425) Human Over-expression Lysate

Sign In for Pricing
View Details
Interleukin 10 (IL10) (Immunoregulation Marker) (IL10/2651R), CF488A conjugate, 0.1mg/mL
BNC882651-500 1x 500 µL

Interleukin 10 (IL10) (Immunoregulation Marker) (IL10/2651R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Rnf214 Mouse Gene Knockout Kit (CRISPR)
KN514938 1 Kit

Rnf214 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details