What is the catalog number for C1QB Peptide - middle region?

The catalog number for C1QB Peptide - middle region is orb1997627.

What sizes are available for C1QB Peptide - middle region?

C1QB Peptide - middle region is available in the following size(s): 100 µg.

Is C1QB Peptide - middle region in stock?

C1QB Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

C1QB Peptide - middle region

Product Specifications

UniProt

P14106

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_033907.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: INSPLRPNQVIRFEKVITNANENYEPRNGKFTCKVPGLYYFTYHASSRGN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TA501356AM 100 µL

SH3PX1 (SNX9) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2G4]

Sign In for Pricing

View Details

NBL1-12773 0.1 mg

LYZL4 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing

View Details

3158-30T 30 µg

Caspase-8 Antibody

Sign In for Pricing

View Details

EM22892 96 Tests

Mouse Angiostatin (Angiostatin) ELISA Kit

Sign In for Pricing

View Details

MBS2709901-01 24 Strip Well

Rat Protein S (PROS) ELISA Kit

Sign In for Pricing

View Details

MBS2709901-02 48 Well

Rat Protein S (PROS) ELISA Kit

Sign In for Pricing

View Details